Skip to product information
1 of 1

PDGF-CC, Human (HEK293, Fc)

PDGF-CC, Human (HEK293, Fc)

Size

SKU:QM-0105210

Price on request
Quantity

Request quote or documents

View full details
  • Description

    PDGF-CC is a multifunctional growth factor that plays a crucial role in embryonic development, cellular processes, and tissue formation. It is essential for embryonic skeletal development, skin morphogenesis, and wound healing. PDGF-CC Protein, Human (HEK293, Fc) is the recombinant human-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

  • Molecular Formula

    56034 (Gene_ID) Q9NRA1-1 (V235-G345) (Accession)

  • Smiles

    VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0105210
1 EachQM-0105210
£0.00/ea
£0.00
£0.00/ea £0.00

PDGF-CC, Human (HEK293, Fc)

PDGF-CC, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.