PDGF R alpha, Rat (HEK293, His)

Name: PDGF R alpha, Rat (HEK293, His)
Brand: QuantiMol
SKU: QM-0204064-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0204064-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
PDGF R alpha protein is a tyrosine protein kinase receptor for PDGFA, PDGFB, and PDGFC that coordinates embryonic development, cell proliferation, survival, and chemotaxis. Their functions vary, promoting or inhibiting cell proliferation and migration depending on the situation. PDGF R alpha Protein, Rat (HEK293, His) is the recombinant rat-derived PDGF R alpha protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
25267 (Gene_ID) NP_036934.1 (L24-E523) (Accession)
Smiles
LLLPSILPNENEKIVPLSSSFSLRCFGESEVSWQHPMSEEEDPNVEIRTEENNSSLFVTVLEVVNASAAHTGWYTCYYNHTQTEESEIEGRHIYIYVPDPDMAFVPLGMTDSLVIVEEDDSAIIPCLTTDPDTEVTLHNNGRLVPASYDSRQGFNGTFSVGPYICEATVRGRTFKTSEFNVYALKATSELNLEMDTRQTVYKAGETIVVTCAVFNNEVVDLQWTYPGEVRNKGITMLEEIKLPSIKLVYTLTVPKATVKDSGDYECAARQATKEVKEMKTVTISVHEKGFVQIRPTFGHLETVNLHQVREFVVEVQAYPTPRISWLKDNLTLIENLTEITTDVQRSQETRYQSKLKLIRAKEEDSGHYTIIVQNDDDMKSYTFELSTLVPASILELVDDHHGSGGGQTVRCTAEGTPLPNIEWMICKDIKKCNNDTSWTVLASNVSNIITEFHQRGRSTVEGRVSFAKVEETIAVRCLAKNDLGIGNRELKLVAPSLRSE
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0204064-01	2 µgQM-0204064-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0204064-02	10 µgQM-0204064-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0204064-03	50 µgQM-0204064-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

100 µgQM-0204064-04	100 µgQM-0204064-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PDGF R alpha, Rat (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.