Skip to product information
1 of 1

PDZD11, Human (His)

PDZD11, Human (His)

Size

SKU:QM-0203813-01

£64.33 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    PDZD11 protein is a key mediator that promotes the docking of ADAM10 to adhesion zonules by interacting with PLEKHA7. PDZD11 is critical for subsequent binding to TSPAN33, which orchestrates complex protein-protein interactions at cellular junctions. PDZD11 Protein, Human (His) is the recombinant human-derived PDZD11 protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    51248 (Gene_ID) Q5EBL8-1 (D2-H140) (Accession)

  • Smiles

    DSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203813-01
5 µgQM-0203813-01
£64.33/ea
£0.00
£64.33/ea £0.00
10 µgQM-0203813-02
10 µgQM-0203813-02
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0203813-03
50 µgQM-0203813-03
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0203813-04
100 µgQM-0203813-04
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PDZD11, Human (His)

PDZD11, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.