Skip to product information
1 of 1

PEA15, Human

PEA15, Human

Size

SKU:QM-0086147

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The PEA15 protein is a regulator of multiple cellular processes that blocks Ras-mediated integrin inhibition and modulates the ERK MAP kinase cascade. It inhibits RPS6KA3 activity by sequestering RPS6KA3 in the cytoplasm, regulating key cellular pathways. PEA15 Protein, Human is the recombinant human-derived PEA15 protein, expressed by E. coli , with tag free.

  • Molecular Formula

    8682 (Gene_ID) Q15121 (M1-A130) (Accession)

  • Smiles

    MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0086147
1 EachQM-0086147
£0.00/ea
£0.00
£0.00/ea £0.00

PEA15, Human

PEA15, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.