Skip to product information
1 of 1

PEDF/Serpin F1, Human (HEK293, N-His)

PEDF/Serpin F1, Human (HEK293, N-His)

Size

SKU:QM-0205342-01

£67.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Serpin F1 protein, a neurotrophic factor, crucially promotes extensive neuronal differentiation in retinoblastoma cells and serves as a potent inhibitor of angiogenesis. Unlike active serpins, Serpin F1 does not undergo the typical S (stressed) to R (relaxed) conformational transition, lacking serine protease inhibitory activity. It also interacts with PNPLA2, enhancing the phospholipase A2 activity of PNPLA2. PEDF/Serpin F1 Protein, Human (HEK293, N-His) is the recombinant human-derived Serpin F1 protein, expressed by HEK293 , with N-6*His labeled tag.

  • Molecular Formula

    5176 (Gene_ID) P36955 (Q20-P418) (Accession)

  • Smiles

    QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0205342-01
5 µgQM-0205342-01
£67.44/ea
£0.00
£67.44/ea £0.00
10 µgQM-0205342-02
10 µgQM-0205342-02
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0205342-03
50 µgQM-0205342-03
£238.32/ea
£0.00
£238.32/ea £0.00
100 µgQM-0205342-04
100 µgQM-0205342-04
£359.82/ea
£0.00
£359.82/ea £0.00
500 µgQM-0205342-05
500 µgQM-0205342-05
£1,046.30/ea
£0.00
£1,046.30/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PEDF/Serpin F1, Human (HEK293, N-His)

PEDF/Serpin F1, Human (HEK293, N-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.