Peptidyl-prolyl cis-trans isomerase A/CYPA, Human (Tag Free)
Peptidyl-prolyl cis-trans isomerase A/CYPA, Human (Tag Free)
SKU:QM-0205958-01
Couldn't load pickup availability
Request quote or documents
Product Details
-
Description
CYPA protein, a peptidyl prolyl cis-trans isomerase, has proinflammatory activity by stimulating activation of NF-kappa-B and ERK, JNK, and p38 MAP kinases. It may act as a mediator between the human SARS coronavirus nucleoprotein and BSG/CD147 during the virus' invasion of host cells. Peptidyl-prolyl cis-trans isomerase A/CYPA Protein, Human is the recombinant human-derived Peptidyl-prolyl cis-trans isomerase A/CYPA protein, expressed by E. coli , with tag free.
-
Molecular Formula
5478 (Gene_ID) P62937-1 (M1-E165) (Accession)
-
Smiles
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
-
Purity
98
-
Storage Conditions
Stored at -20°C for 2 years
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0054857-01 α-Ketoglutaric acid (disodium dihydrate) [CAS 1282616-74-3]
- QM-0054003 δ-Hexachlorocyclohexane-13C6
- QM-0053803 γ-Linolenic acid ethyl ester-d5
- QM-0052819-01 Zolpidem phenyl-4-carboxylic acid ethyl ester-d6 [CAS 1216455-48-9]
- QM-0052711 α-D-Glucopyranoside, 2-chloro-4-nitrophenyl, 2,3,4,6-tetraacetate [CAS 153823-58-6]
- QM-0052492-01 α-D-Galactopyranose,2- (acetylamino) -2-deoxy-,1,3,4,6-tetraacetate [CAS 10385-50-9]
- QM-0051894-01 β-D-Glucopyranoside,2-bromoethyl,2,3,4,6-tetraacetate [CAS 16977-78-9]
- QM-0051893 β-D-Glucopyranoside,2-chloro-4-nitrophenyl,2,3,4,6-tetraacetate [CAS 35023-71-3]
- QM-0051820-01 β-D-Glucopyranuronic acid, methyl ester,1,2,3,4-tetrakis (2-methylpropanoate) [CAS 150607-94-6]
- QM-0051622-01 α-Ketoglutaric acid (disodium hydrate)
Other industry favorites
- QM-0054857-01 α-Ketoglutaric acid (disodium dihydrate) [CAS 1282616-74-3]
- QM-0054003 δ-Hexachlorocyclohexane-13C6
- QM-0206023-01 α-Demethylnaproxen [CAS 23981-47-7]
- QM-0203548-01 α-Acetobromo-D-xylose, 95% [CAS 3068-31-3]
- QM-0071124 β-D-Ribofuranose, 3-deoxy-3-fluoro-, 1,2-diacetate 5- (4-methylbenzoate) [CAS 1884324-98-4]
- QM-0131262 [Thr28, Nle31]-Cholecystokinin (25-33), sulfated [CAS 77568-41-3]
- QM-0023392 α-Mycolic acid, keto cis [CAS 2260795-20-6]
- QM-0022881 [R- (Z) ]-4-Amino-3-chloro-2-pen-tenedioicacid [CAS 90288-29-2]
- QM-0167516 α-D-Glucopyranoside, methyl 4-deoxy-4-fluoro,2,3,6-tribenzoate [CAS 84065-98-5]
- QM-0166583-01 β-D-Galactosyl- (1→3) -N-acetyl-D-galactosamine [CAS 3554-90-3]
Peptidyl-prolyl cis-trans isomerase A/CYPA, Human (Tag Free)
Peptidyl-prolyl cis-trans isomerase A/CYPA, Human (Tag Free) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.