Skip to product information
1 of 1

Persephin, Human

Persephin, Human

Size

SKU:QM-0193644-01

£120.63 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Persephin protein is a disulfide-linked homodimer with neurotrophic activity that specifically benefits midbrain dopaminergic and motor neurons. Its unique ability to target these populations suggests that it plays a special role in supporting their survival and function. Persephin Protein, Human is the recombinant human-derived Persephin protein, expressed by E. coli , with tag free.

  • Molecular Formula

    5623 (Gene_ID) O60542 (A61-G156) (Accession)

  • Smiles

    ALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG

  • Purity

    99.9

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0193644-01
10 µgQM-0193644-01
£120.63/ea
£0.00
£120.63/ea £0.00
50 µgQM-0193644-02
50 µgQM-0193644-02
£337.95/ea
£0.00
£337.95/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Persephin, Human

Persephin, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.