Skip to product information
1 of 1

PF-4/CXCL4, Mouse

PF-4/CXCL4, Mouse

Size

SKU:QM-0200290-01

£111.63 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Platelet factor 4 (PF4) is released during platelet aggregation and neutralizes the anticoagulant effect of heparin with a higher binding affinity than chondroitin 4-sulfate chains. In addition to its anticoagulant effects, PF4 induces neutrophil and monocyte chemotaxis, thereby promoting immune responses. PF-4/CXCL4 Protein, Mouse is the recombinant mouse-derived Platelet factor 4 protein, expressed by E. coli , with tag free.

  • Molecular Formula

    56744 (Gene_ID) Q9Z126 (V30-S105) (Accession)

  • Smiles

    VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0200290-01
5 µgQM-0200290-01
£111.63/ea
£0.00
£111.63/ea £0.00
10 µgQM-0200290-02
10 µgQM-0200290-02
£210.38/ea
£0.00
£210.38/ea £0.00
50 µgQM-0200290-03
50 µgQM-0200290-03
£492.26/ea
£0.00
£492.26/ea £0.00
100 µgQM-0200290-04
100 µgQM-0200290-04
£802.09/ea
£0.00
£802.09/ea £0.00
500 µgQM-0200290-05
500 µgQM-0200290-05
£1,821.47/ea
£0.00
£1,821.47/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PF-4/CXCL4, Mouse

PF-4/CXCL4, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.