PF-4/CXCL4, Mouse (HEK293, Fc)

Name: PF-4/CXCL4, Mouse (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0199416-01
Price: 235.9 GBP
Availability: InStock

Size 20 µg 50 µg 100 µg

SKU:QM-0199416-01

£235.90 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
PF-4/CXCL4 is a member of the CXC chemokine family that is released from the alpha-granules of activated platelets. PF-4/CXCL4 binds with high affinity to heparin, with antiheparin, antiangiogenic and immunomodulatory activities. PF-4/CXCL4 plays a role in hematopoiesis and immune cell modulation[1][2]. PF-4/CXCL4 Protein, Mouse (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 76 amino acids (V30-S105) .
Molecular Formula
56744 (Gene_ID) Q9Z126 (V30-S105) (Accession)
Smiles
VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
20 µgQM-0199416-01	20 µgQM-0199416-01 £235.90/ea	£0.00	Quantity	£235.90/ea	£0.00

50 µgQM-0199416-02	50 µgQM-0199416-02 £459.45/ea	£0.00	Quantity	£459.45/ea	£0.00

100 µgQM-0199416-03	100 µgQM-0199416-03 £736.48/ea	£0.00	Quantity	£736.48/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PF-4/CXCL4, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.