Skip to product information
1 of 1

PF4V1, Human (HEK293, Fc)

PF4V1, Human (HEK293, Fc)

Size

SKU:QM-0202575-01

£76.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    PF4V1, also known as CXCL4L1, is a non-allelic variant of CXCL4. PF4V1 is a platelet-associated chemokine, and it binds to heparin is much weaker than in the close homolog PF4/CXCL4. PF4V1 is an inhibitor of angiogenesis and inhibitor of endothelial cell chemotaxis. PF4V1 is involved in inflammation, angiogenesis, and cancer[1][2]. PF4V1 Protein, Human (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 104 amino acids (M1-S104) .

  • Molecular Formula

    5197 (Gene_ID) NP_002611.1 (F31-S104) (Accession)

  • Smiles

    FARAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES

  • Purity

    97.35

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202575-01
5 µgQM-0202575-01
£76.75/ea
£0.00
£76.75/ea £0.00
10 µgQM-0202575-02
10 µgQM-0202575-02
£117.25/ea
£0.00
£117.25/ea £0.00
50 µgQM-0202575-03
50 µgQM-0202575-03
£327.02/ea
£0.00
£327.02/ea £0.00
100 µgQM-0202575-04
100 µgQM-0202575-04
£515.35/ea
£0.00
£515.35/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PF4V1, Human (HEK293, Fc)

PF4V1, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.