Skip to product information
1 of 1

PFDN1, Mouse (His)

PFDN1, Mouse (His)

Size

SKU:QM-0202932-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The PFDN1 protein is a key player in the immune response, presenting antigen to CD4 T cells by accommodating 10-30 residue peptides in its peptide-binding cleft. PFDN1 plays a role in the endocytic pathway of antigen-presenting cells, specifically in the exogenous antigen presentation pathway, forming heteromers with three MHC class II molecules and a CD74 trimer in the endoplasmic reticulum. PFDN1 Protein, Mouse (His) is the recombinant mouse-derived PFDN1 protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    67199 (Gene_ID) Q9CQF7 (M1-Q122) (Accession)

  • Smiles

    MAASVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEVIHNQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ

  • Purity

    92.3

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0202932-01
2 µgQM-0202932-01
£52.94/ea
£0.00
£52.94/ea £0.00
5 µgQM-0202932-02
5 µgQM-0202932-02
£76.75/ea
£0.00
£76.75/ea £0.00
10 µgQM-0202932-03
10 µgQM-0202932-03
£111.63/ea
£0.00
£111.63/ea £0.00
50 µgQM-0202932-04
50 µgQM-0202932-04
£288.14/ea
£0.00
£288.14/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PFDN1, Mouse (His)

PFDN1, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.