PFDN2, Human (His)

Name: PFDN2, Human (His)
Brand: QuantiMol
SKU: QM-0202329-01
Price: 111.63 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202329-01

£111.63 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The PFDN2 protein selectively binds to the cytoplasmic chaperone protein (c-CPN) and directs the protein for targeted transfer. It also interacts with nascent peptides and actively promotes correct folding in complex cellular environments. PFDN2 Protein, Human (His) is the recombinant human-derived PFDN2 protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
5202 (Gene_ID) Q9UHV9 (M1-S154) (Accession)
Smiles
MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS
Purity
96.9
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202329-01	5 µgQM-0202329-01 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

10 µgQM-0202329-02	10 µgQM-0202329-02 £207.95/ea	£0.00	Quantity	£207.95/ea	£0.00

50 µgQM-0202329-03	50 µgQM-0202329-03 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

100 µgQM-0202329-04	100 µgQM-0202329-04 £802.09/ea	£0.00	Quantity	£802.09/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PFDN2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.