Skip to product information
1 of 1

PFDN5, Human (His)

PFDN5, Human (His)

Size

SKU:QM-0203847-01

£101.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    PFDN5 protein selectively binds to cytosolic chaperonin (c-CPN), facilitating targeted protein transfer and promoting nascent polypeptide folding. Beyond its chaperone function, PFDN5 regulates MYC transcriptional activity by forming a heterohexamer. It interacts with MYC's N-terminal domain, showcasing a multifaceted role in cellular processes, bridging protein folding and transcriptional regulation. PFDN5 Protein, Human (His) is the recombinant human-derived PFDN5 protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    5204 (Gene_ID) Q99471 (M1-A154) (Accession)

  • Smiles

    MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA

  • Purity

    90.04

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203847-01
5 µgQM-0203847-01
£101.50/ea
£0.00
£101.50/ea £0.00
10 µgQM-0203847-02
10 µgQM-0203847-02
£188.51/ea
£0.00
£188.51/ea £0.00
50 µgQM-0203847-03
50 µgQM-0203847-03
£442.44/ea
£0.00
£442.44/ea £0.00
100 µgQM-0203847-04
100 µgQM-0203847-04
£714.61/ea
£0.00
£714.61/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PFDN5, Human (His)

PFDN5, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.