Skip to product information
1 of 1

PGD, Human (HEK293, His)

PGD, Human (HEK293, His)

Size

SKU:QM-0191776-01

£126.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    PGD Protein, Human (HEK293, His) is a homodimeric protein, with an N-terminal His tag. Recombinant Human PGD, His (HEK293-expressed) is a key enzyme that converts 6-phosphogluconate into ribulose-5-phosphate with NADP+ as cofactor in the pentose phosphate pathway (PPP) [1].

  • Molecular Formula

    5226 (Gene_ID) P52209-1 (M1-A483) (Accession)

  • Smiles

    MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNAHHHHHH

  • Purity

    95.05

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0191776-01
10 µgQM-0191776-01
£126.50/ea
£0.00
£126.50/ea £0.00
50 µgQM-0191776-02
50 µgQM-0191776-02
£307.06/ea
£0.00
£307.06/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PGD, Human (HEK293, His)

PGD, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.