PGD2 Synthase/PTGDS, Rat (HEK293, His)

Name: PGD2 Synthase/PTGDS, Rat (HEK293, His)
Brand: QuantiMol
SKU: QM-0195551-01
Price: 78.82 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0195551-01

£78.82 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The PGD2 synthase/PTGDS protein converts PGH2 to PGD2, which regulates smooth muscle and inhibits platelet aggregation.It affects central nervous system functions including sedation, NREM sleep, and potential anti-apoptotic effects on oligodendrocytes.PGD2 Synthase/PTGDS Protein, Rat (HEK293, His) is the recombinant rat-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His, C-6*His labeled tag.
Molecular Formula
25526 (Gene_ID) P22057/NP_037147.1 (Q25-E189) (Accession)
Smiles
QGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKELLFMCQTVVAPSTEGGLNLTSTFLRKNQCETKVMVLQPAGVPGQYTYNSPHWGSFHSLSVVETDYDEYAFLFSKGTKGPGQDFRMATLYSRAQLLKEELKEKFITFSKDQGLTEEDIVFLPQPDKCIQE
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0195551-01	5 µgQM-0195551-01 £78.82/ea	£0.00	Quantity	£78.82/ea	£0.00

10 µgQM-0195551-02	10 µgQM-0195551-02 £122.88/ea	£0.00	Quantity	£122.88/ea	£0.00

50 µgQM-0195551-03	50 µgQM-0195551-03 £348.89/ea	£0.00	Quantity	£348.89/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PGD2 Synthase/PTGDS, Rat (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.