PHYH, Human

Name: PHYH, Human
Brand: QuantiMol
SKU: QM-0205095-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 5 µg 10 µg 50 µg 100 µg

SKU:QM-0205095-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
PHYH protein catalyzes 2-hydroxylation of various mono-branched and straight-chain acyl-CoA esters, including racemic phytanoyl-CoA and isomers of 3-methylhexadecanoyl-CoA. It acts on acyl-CoAs with a chain length of at least seven carbon atoms, excluding long, very long straight-chain, and 2-methyl or 4-methyl-branched acyl-CoAs. PHYH Protein, Human is the recombinant human-derived PHYH protein, expressed by E. coli , with tag free.
Molecular Formula
5264 (Gene_ID) O14832-1 (S31-L338) (Accession)
Smiles
SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0205095-01	2 µgQM-0205095-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

5 µgQM-0205095-02	5 µgQM-0205095-02 £88.00/ea	£0.00	Quantity	£88.00/ea	£0.00

10 µgQM-0205095-03	10 µgQM-0205095-03 £122.88/ea	£0.00	Quantity	£122.88/ea	£0.00

50 µgQM-0205095-04	50 µgQM-0205095-04 £305.15/ea	£0.00	Quantity	£305.15/ea	£0.00

100 µgQM-0205095-05	100 µgQM-0205095-05 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PHYH, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.