Skip to product information
1 of 1

PIGR, Human (G365S, HEK293, His)

PIGR, Human (G365S, HEK293, His)

Size

SKU:QM-0183198-01

£227.39 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    PIGR proteins play a critical role in mediating the selective transcytosis of polymerized IgA and IgM across mucosal epithelial cells, which is critical for mucosal immunity. PIGR binds these immunoglobulins at the basolateral surface, forming a complex that is transported intracellularly and secreted apically. PIGR Protein, Human (G365S, HEK293, His) is the recombinant human-derived PIGR protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    5284 (Gene_ID) P01833/NP_002635.2 (K19-R638, G365S) (Accession)

  • Smiles

    KSPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGARGGCITLISSEGYVSSKYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVSQGPGLLNDTKVYTVDLGRTVTINCPFKTENAQKRKSLYKQIGLYPVLVIDSSGYVNPNYTGRIRLDIQGTGQLLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHSDGQLQEGSPIQAWQLFVNEESTIPRSPTVVKGVAGGSVAVLCPYNRKESKSIKYWCLWEGAQNGRCPLLVDSEGWVKAQYEGRLSLLEEPGNGTFTVILNQLTSRDAGFYWCLTNGDTLWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKVPCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYVAVEERKAAGSRDVSLAKADAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVADTRDQADGSRASVDSGSSEEQGGSSR

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0183198-01
10 µgQM-0183198-01
£227.39/ea
£0.00
£227.39/ea £0.00
50 µgQM-0183198-02
50 µgQM-0183198-02
£548.15/ea
£0.00
£548.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PIGR, Human (G365S, HEK293, His)

PIGR, Human (G365S, HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.