PILR-alpha, Human (178a.a, HEK293, Fc)

Name: PILR-alpha, Human (178a.a, HEK293, Fc)
Brand: QuantiMol
SKU: QM-0169587-01
Price: 77.78 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0169587-01

£77.78 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
PILR-α is a member of the paired receptor family and functions as an inhibitory signaling receptor in immune regulation. It inhibits signal transduction by recruiting the phosphatases PTPN6/SHP-1 and PTPN11/SHP-2, blocking the phosphorylation of key signaling molecules. PILR-alpha Protein, Human (178a.a, HEK293, Fc) is the recombinant human-derived PILR-alpha protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
29992 (Gene_ID) Q9UKJ1-1 (Q20-A197) (Accession)
Smiles
QPSGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELDTRSSGRQQWQSIEGTKLSITQAVTTTTQRPSSMTTTWRLSSTTTTTGLRVTQGKRRSDSWHISLETA
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0169587-01	5 µgQM-0169587-01 £77.78/ea	£0.00	Quantity	£77.78/ea	£0.00

10 µgQM-0169587-02	10 µgQM-0169587-02 £122.88/ea	£0.00	Quantity	£122.88/ea	£0.00

50 µgQM-0169587-03	50 µgQM-0169587-03 £342.81/ea	£0.00	Quantity	£342.81/ea	£0.00

100 µgQM-0169587-04	100 µgQM-0169587-04 £548.15/ea	£0.00	Quantity	£548.15/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PILR-alpha, Human (178a.a, HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.