Name: PILR-alpha, Mouse (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0169529-01
Price: 76.75 GBP
Availability: InStock

Product Details

Description
PILR-alpha Protein, a key member of paired immune system regulators, acts as a receptor for CD99 and PIANP. Its interactions with CD99 highlight its role in cellular recognition and immune response modulation. Paired receptors, featuring activating and inhibitory forms, finely tune immune system regulation. PILR-alpha's observed ligand interactions underscore its importance in mediating immune responses and cellular recognition processes. PILR-alpha Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-alpha protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
231805 (Gene_ID) Q2YFS3 (E32-V197) (Accession)
Smiles
ERSNRKNGFGVNQPESCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWRWKDFHGEFIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQTRYFGRVFLQTTEGIQFWQSIPGTQLNVTNATCTPTTLPSTTAATSAHTQNDITEVKSANIGGLDLQTTV
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0169529-01	5 µgQM-0169529-01 £76.75/ea	£0.00	Quantity	£76.75/ea	£0.00

10 µgQM-0169529-02	10 µgQM-0169529-02 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

20 µgQM-0169529-03	20 µgQM-0169529-03 £193.37/ea	£0.00	Quantity	£193.37/ea	£0.00

50 µgQM-0169529-04	50 µgQM-0169529-04 £359.82/ea	£0.00	Quantity	£359.82/ea	£0.00

100 µgQM-0169529-05	100 µgQM-0169529-05 £548.15/ea	£0.00	Quantity	£548.15/ea	£0.00

500 µgQM-0169529-06	500 µgQM-0169529-06 £1,323.32/ea	£0.00	Quantity	£1,323.32/ea	£0.00

1 mgQM-0169529-07	1 mgQM-0169529-07 £1,986.71/ea	£0.00	Quantity	£1,986.71/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PILR-alpha, Mouse (HEK293, Fc)

PILR-alpha, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.