PILR-beta, Mouse (HEK293, Fc)

Name: PILR-beta, Mouse (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0204581-01
Price: 58.12 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0204581-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)
Smiles
GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG
Purity
91.5
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204581-01	5 µgQM-0204581-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0204581-02	10 µgQM-0204581-02 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

50 µgQM-0204581-03	50 µgQM-0204581-03 £232.25/ea	£0.00	Quantity	£232.25/ea	£0.00

100 µgQM-0204581-04	100 µgQM-0204581-04 £359.82/ea	£0.00	Quantity	£359.82/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PILR-beta, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.