PITPNA, Human (His)
PITPNA, Human (His)
SKU:QM-0096598
Request quote or documents
Product Details
-
Description
PITPNA Protein catalyzes phosphatidylinositol (PI) and phosphatidylcholine (PC) transfer between membranes, displaying a preference for shorter saturated or monosaturated acyl chains at sn-1 and sn-2 positions. For PC, the preference order is C16:1 > C16:0 > C18:1 > C18:0 > C20:4, and for PI, it is C16:1 > C16:0 > C18:1 > C18:0 > C20:4 > C20:3. PITPNA Protein, Human (His) is the recombinant human-derived PITPNA protein, expressed by E. coli , with N-6*His labeled tag.
-
Molecular Formula
5306 (Gene_ID) Q00169 (M1-D270) (Accession)
-
Smiles
MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD
-
Shipping Conditions
Dry ice.
Related Products
- QM-0046499 Xpnpep3 Rat Pre-designed siRNA Set A
- QM-0043980 Xpnpep1 Rat Pre-designed siRNA Set A
- QM-0042997 Xpnpep2 Rat Pre-designed siRNA Set A
- QM-0039984 Xpnpep3 Mouse Pre-designed siRNA Set A
- QM-0037490 Xpnpep1 Mouse Pre-designed siRNA Set A
- QM-0036518 Xpnpep2 Mouse Pre-designed siRNA Set A
- QM-0025936-01 Z-Val-Lys-Met-AMC (TFA)
- QM-0025934 Z-VEID-AFC (TFA)
- QM-0025807 Z-LRGG-AMC (TFA)
- QM-0020831 X-GAL (solution) [CAS 7240-90-6]
Other industry favorites
- QM-0046499 Xpnpep3 Rat Pre-designed siRNA Set A
- QM-0043980 Xpnpep1 Rat Pre-designed siRNA Set A
- QM-0158040-01 Triamcinolone [CAS 124-94-7]
- QM-0152746-01 X-GAL [CAS 7240-90-6]
- QM-0160938-01 β-Ala-Lys (AMCA) [CAS 180342-52-3]
- QM-0172351-01 Z-Gly-Gly-Arg-AMC [CAS 66216-78-2]
- QM-0079583-01 UAMC-1110 [CAS 1448440-52-5]
- QM-0205960-01 Triamcinolone hexacetonide [CAS 5611-51-8]
- QM-0184815-01 Z-DEVD-AMC
- QM-0147714-01 Z-Leu-Arg-AMC [CAS 156192-32-4]
PITPNA, Human (His)
PITPNA, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.