Skip to product information
1 of 1

PLA2G16, Human (His)

PLA2G16, Human (His)

Size

SKU:QM-0178544-01

£172.63 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The PLA2G16 protein has dual functions, acting as a phospholipase to exert calcium-independent PLA1 and PLA2 activities, preferentially releasing fatty acids through PLA1. It also acts as an O-acyltransferase and N-acyltransferase, helping to form N-acylphosphatidylethanolamine (the precursor of N-acylethanolamine) . PLA2G16 Protein, Human (His) is the recombinant human-derived PLA2G16 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    11145 (Gene_ID) P53816 (D12-D132) (Accession)

  • Smiles

    DLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRD

  • Purity

    95

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0178544-01
10 µgQM-0178544-01
£172.63/ea
£0.00
£172.63/ea £0.00
50 µgQM-0178544-02
50 µgQM-0178544-02
£473.52/ea
£0.00
£473.52/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PLA2G16, Human (His)

PLA2G16, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.