PLA2G1B, Human (HEK293, His)

Name: PLA2G1B, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0194215-01
Price: 263.32 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0194215-01

£263.32 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The PLA2G1B protein is a secreted calcium-dependent phospholipase A2 that targets dietary phospholipids in the intestine. It hydrolyzes the fatty acyl group at the sn-2 position, preferentially hydrolyzing phosphatidylethanolamine and phosphatidylglycerol. PLA2G1B Protein, Human (HEK293, His) is the recombinant human-derived PLA2G1B protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
5319 (Gene_ID) P04054 (A23-S148) (Accession)
Smiles
AVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS
Purity
98
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0194215-01	10 µgQM-0194215-01 £263.32/ea	£0.00	Quantity	£263.32/ea	£0.00

50 µgQM-0194215-02	50 µgQM-0194215-02 £639.98/ea	£0.00	Quantity	£639.98/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PLA2G1B, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.