Name: PLA2G2D, Human (His-SUMO)
Brand: QuantiMol
SKU: QM-0202671-01
Price: 69.5 GBP
Availability: InStock

Product Details

Description
PLA2G2D protein is a secreted calcium-dependent phospholipase A2 that targets extracellular lipids and has anti-inflammatory and immunosuppressive functions.It hydrolyzes the fatty acyl group at the sn-2 position, preferentially hydrolyzing phosphatidylethanolamine and phosphatidylglycerol.PLA2G2D Protein, Human (His-SUMO) is the recombinant human-derived PLA2G2D protein, expressed by E.coli , with N-His, N-SUMO labeled tag.
Molecular Formula
26279 (Gene_ID) Q9UNK4 (I22-C145) (Accession)
Smiles
ILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202671-01	5 µgQM-0202671-01 £69.50/ea	£0.00	Quantity	£69.50/ea	£0.00

10 µgQM-0202671-02	10 µgQM-0202671-02 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

20 µgQM-0202671-03	20 µgQM-0202671-03 £145.38/ea	£0.00	Quantity	£145.38/ea	£0.00

50 µgQM-0202671-04	50 µgQM-0202671-04 £337.95/ea	£0.00	Quantity	£337.95/ea	£0.00

100 µgQM-0202671-05	100 µgQM-0202671-05 £515.35/ea	£0.00	Quantity	£515.35/ea	£0.00

500 µgQM-0202671-06	500 µgQM-0202671-06 £1,488.56/ea	£0.00	Quantity	£1,488.56/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PLA2G2D, Human (His-SUMO)

PLA2G2D, Human (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.