PLAC9, Human (HEK293, Fc)

Name: PLAC9, Human (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0203410-01
Price: 67.44 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203410-01

£67.44 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
PLAC9 Protein, Human (HEK293, Fc) is the recombinant human-derived PLAC9 protein, expressed by HEK293, with C-mFc labeled tag.
Molecular Formula
219348 (Gene_ID) Q5JTB6 (A23-F97) (Accession)
Smiles
AEPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDGF
Purity
95.4
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203410-01	5 µgQM-0203410-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0203410-02	10 µgQM-0203410-02 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

50 µgQM-0203410-03	50 µgQM-0203410-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

100 µgQM-0203410-04	100 µgQM-0203410-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PLAC9, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.