1 1

Placental Lactogen/CSH1, Human (HEK293, His)

Placental Lactogen/CSH1, Human (HEK293, His)

Size

QM-0182391-01

£193.37 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Placental Lactogen/CSH1 Protein, exclusive to pregnancy, orchestrates lactation, fetal growth, and metabolism. Its unique mode of action involves zinc-induced dimerization of the Prolactin Receptor (PRLR), distinct from the Growth Hormone Receptor (GHR) . This specificity and structural versatility underline its pivotal role in intricate pregnancy-related processes and maternal physiology. Placental Lactogen/CSH1 Protein, Human (HEK293, His) is the recombinant human-derived Placental Lactogen/CSH1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    1442 (Gene_ID) P0DML2 (V27-F217) (Accession)

  • Smiles

    VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
10 µgQM-0182391-01
10 µgQM-0182391-01
£193.37/ea		 £0.00
£193.37/ea £0.00
50 µgQM-0182391-02
50 µgQM-0182391-02
£481.32/ea		 £0.00
£481.32/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Placental Lactogen/CSH1, Human (HEK293, His)

Placental Lactogen/CSH1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.