Skip to product information
1 of 1

Plasminogen, Human

Plasminogen, Human

Size

SKU:QM-0027573-01

£127.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Plasminogen protein is the key precursor of plasmin and plays a central role in a variety of physiological and pathological processes. Plasmin is derived from plasminogen and dissolves fibrin during blood coagulation, affecting embryonic development, tissue remodeling, tumor invasion and inflammation. Plasminogen Protein, Human is the recombinant human-derived Plasminogen protein, expressed by E. coli , with tag free.

  • Molecular Formula

    5340 (Gene_ID) P00747 (V98-P356) (Accession)

  • Smiles

    VYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSP

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0027573-01
10 µgQM-0027573-01
£127.38/ea
£0.00
£127.38/ea £0.00
50 µgQM-0027573-02
50 µgQM-0027573-02
£381.69/ea
£0.00
£381.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Plasminogen, Human

Plasminogen, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.