Skip to product information
1 of 1

PLAU/uPA, Human (HEK293, His, solution)

PLAU/uPA, Human (HEK293, His, solution)

Size

SKU:QM-0172779-01

£162.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    UPA chain A Protein, a key player in the plasminogen activation system, selectively cleaves plasminogen, initiating fibrinolysis and contributing to tissue remodeling. Its precision underscores its role in regulating proteolytic activity, emphasizing its significance in the cascade of events leading to fibrinolysis and extracellular matrix remodeling in various physiological processes. PLAU/uPA Protein, Human (HEK293, His, solution) is the recombinant human-derived PLAU/uPA protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    5328 (Gene_ID) P00749-1 (S21-L431) (Accession)

  • Smiles

    SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0172779-01
10 µgQM-0172779-01
£162.50/ea
£0.00
£162.50/ea £0.00
50 µgQM-0172779-02
50 µgQM-0172779-02
£401.83/ea
£0.00
£401.83/ea £0.00
100 µgQM-0172779-03
100 µgQM-0172779-03
£629.04/ea
£0.00
£629.04/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PLAU/uPA, Human (HEK293, His, solution)

PLAU/uPA, Human (HEK293, His, solution) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.