Skip to product information
1 of 1

PLBD2, Rat (His-SUMO)

PLBD2, Rat (His-SUMO)

Size

SKU:QM-0114628

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The PLBD2 protein is a putative phospholipase that may participate in cellular processes by interacting with IGF2R. Although the function and mechanism of the enzyme are unclear, its association with IGF2R suggests involvement in the insulin-like growth factor 2 receptor-related signaling pathway. PLBD2 Protein, Rat (His-SUMO) is the recombinant rat-derived PLBD2 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

  • Molecular Formula

    246120 (Gene_ID) Q4QQW8 (G36-D585) (Accession)

  • Smiles

    GALPTLGPGWRRQNPEPPASRTRSLLLDAASGQLRLEYGFHPDAVAWANLTNAIRETGWAYLDLGTNGSYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKSFLEANLEWMQREMELSPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFNIKPLGFLLLQISGDLEDLEPALNKTNTKPSVGSGSCSALIKLLPGSHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLIAGNNLIFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNIVANRLALDGATWADVFRRFNSGTYNNQWMIVDYKAFIPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFESVFNASGLQALVAQYGDWFSYTRNPRAKIFQRDQSLVEDVDTMVRLMRYNDFLHDPLSLCEACSPKPNAENAISARSDLNPANGSYPFQALRQRAHGGIDVKVTSVALAKYMSMLAASGPTWDQLPPFQWSKSPFHNMLHMGQPDLWMFSPVKVPWD

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0114628
1 EachQM-0114628
£0.00/ea
£0.00
£0.00/ea £0.00

PLBD2, Rat (His-SUMO)

PLBD2, Rat (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.