Skip to product information
1 of 1

Pleiotrophin, Human

Pleiotrophin, Human

Size

SKU:QM-0027561-01

£101.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Pleiotrophin is a secreted growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors to influence a variety of cellular processes. It binds to chondroitin sulfate (CS) groups, regulates proliferation, survival and differentiation, and inhibits long-term synaptic potentiation of neurons. Pleiotrophin Protein, Human is the recombinant human-derived Pleiotrophin protein, expressed by E. coli , with tag free. The total length of Pleiotrophin Protein, Human is 136 a.a., with molecular weight of ~15.3 kDa.

  • Molecular Formula

    5764 (Gene_ID) P21246 (G33-D168) (Accession)

  • Smiles

    GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0027561-01
5 µgQM-0027561-01
£101.50/ea
£0.00
£101.50/ea £0.00
10 µgQM-0027561-02
10 µgQM-0027561-02
£147.63/ea
£0.00
£147.63/ea £0.00
50 µgQM-0027561-03
50 µgQM-0027561-03
£392.63/ea
£0.00
£392.63/ea £0.00
100 µgQM-0027561-04
100 µgQM-0027561-04
£604.04/ea
£0.00
£604.04/ea £0.00
500 µgQM-0027561-05
500 µgQM-0027561-05
£1,986.71/ea
£0.00
£1,986.71/ea £0.00
1 mgQM-0027561-06
1 mgQM-0027561-06
£3,149.47/ea
£0.00
£3,149.47/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Pleiotrophin, Human

Pleiotrophin, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.