Skip to product information
1 of 1

PLXDC2, Mouse (HEK293, His)

PLXDC2, Mouse (HEK293, His)

Size

SKU:QM-0205977-01

£107.13 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The PLXDC2 protein is associated with tumor angiogenesis, suggesting its potential role in blood vessel growth in the tumor microenvironment. The specific mechanism and downstream signaling pathways by which PLXDC2 promotes tumor angiogenesis need to be further elucidated, thus prompting people to explore its role in promoting vascularization during tumorigenesis. PLXDC2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLXDC2 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    67448 (Gene_ID) Q9DC11 (E31-A455) (Accession)

  • Smiles

    EPGHHTNDWIYEVTNAFPWNEEGVEVDSQAYNHRWKRNVDPFKAVDTNRASMGQASPESKGFTDLLLDDGQDNNTQIEEDTDHNYYISRIYGPADSASRDLWVNIDQMEKDKVKIHGILSNTHRQAARVNLSFDFPFYGHFLNEVTVATGGFIYTGEVVHRMLTATQYIAPLMANFDPSVSRNSTVRYFDNGTALVVQWDHVHLQDNYNLGSFTFQATLLMDGRIIFGYKEIPVLVTQISSTNHPVKVGLSDAFVVVHRIQQIPNVRRRTIYEYHRVELQMSKITNISAVEMTPLPTCLQFNGCGPCVSSQIGFNCSWCSKLQRCSSGFDRHRQDWVDSGCPEEVQSKEKMCEKTEPGETSQTTTTSHTTTMQFRVLTTTRRAVTSQMPTSLPTEDDTKIALHLKDSGASTDDSAAEKKGGTLHA

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0205977-01
5 µgQM-0205977-01
£107.13/ea
£0.00
£107.13/ea £0.00
10 µgQM-0205977-02
10 µgQM-0205977-02
£199.44/ea
£0.00
£199.44/ea £0.00
50 µgQM-0205977-03
50 µgQM-0205977-03
£437.58/ea
£0.00
£437.58/ea £0.00
100 µgQM-0205977-04
100 µgQM-0205977-04
£669.65/ea
£0.00
£669.65/ea £0.00
250 µgQM-0205977-05
250 µgQM-0205977-05
£1,100.97/ea
£0.00
£1,100.97/ea £0.00
500 µgQM-0205977-06
500 µgQM-0205977-06
£1,433.88/ea
£0.00
£1,433.88/ea £0.00
1 mgQM-0205977-07
1 mgQM-0205977-07
£2,153.16/ea
£0.00
£2,153.16/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PLXDC2, Mouse (HEK293, His)

PLXDC2, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.