PMP2, Human (His)

Name: PMP2, Human (His)
Brand: QuantiMol
SKU: QM-0184436-01
Price: 227.39 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0184436-01

£227.39 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The PMP2 protein may act as a lipid transporter within Schwann cells, suggesting a role in lipid transport and cellular homeostasis. PMP2 may also bind cholesterol, suggesting involvement in cholesterol-related pathways. PMP2 Protein, Human (His) is the recombinant human-derived PMP2 protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
5375 (Gene_ID) P02689 (M1-V132) (Accession)
Smiles
MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0184436-01	10 µgQM-0184436-01 £227.39/ea	£0.00	Quantity	£227.39/ea	£0.00

50 µgQM-0184436-02	50 µgQM-0184436-02 £548.15/ea	£0.00	Quantity	£548.15/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PMP2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.