PMVK, Human (His)
PMVK, Human (His)
SKU:QM-0106372
Request quote or documents

Product Details
-
Description
PMVK proteins play a key role in cellular metabolism by catalyzing the reversible ATP-dependent phosphorylation of mevalonate 5-phosphate, leading to the production of mevalonate diphosphate and ADP. This enzymatic activity represents a key step in the mevalonate-mediated biosynthesis of isopentenyl diphosphate, a precursor for the synthesis of various polyisoprene metabolites. PMVK Protein, Human (His) is the recombinant human-derived PMVK protein, expressed by E. coli , with N-6*His labeled tag.
-
Molecular Formula
10654 (Gene_ID) Q15126 (M1-L192) (Accession)
-
Smiles
MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL
-
Shipping Conditions
Dry ice.
Related Products
Other industry favorites
PMVK, Human (His)
PMVK, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.