Skip to product information
1 of 1

PMVK, Human (His)

PMVK, Human (His)

Size

SKU:QM-0106372

Price on request
Quantity

Request quote or documents

View full details
  • Description

    PMVK proteins play a key role in cellular metabolism by catalyzing the reversible ATP-dependent phosphorylation of mevalonate 5-phosphate, leading to the production of mevalonate diphosphate and ADP. This enzymatic activity represents a key step in the mevalonate-mediated biosynthesis of isopentenyl diphosphate, a precursor for the synthesis of various polyisoprene metabolites. PMVK Protein, Human (His) is the recombinant human-derived PMVK protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    10654 (Gene_ID) Q15126 (M1-L192) (Accession)

  • Smiles

    MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0106372
1 EachQM-0106372
£0.00/ea
£0.00
£0.00/ea £0.00

PMVK, Human (His)

PMVK, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.