Skip to product information
1 of 1

PPARD, Human (HEK293, His)

PPARD, Human (HEK293, His)

Size

SKU:QM-0027866

Price on request
Quantity

Request quote or documents

View full details
  • Description

    PPARD protein is a ligand-activated transcription factor that critically mediates energy metabolism in adipose tissue. As a receptor, it selectively binds peroxisome proliferators, including hypolipidemic drugs and fatty acids, and preferentially binds polyunsaturated substances. PPARD Protein, Human (HEK293, His) is the recombinant human-derived PPARD protein, expressed by HEK293, with C-6*His labeled tag.

  • Molecular Formula

    5467 (Gene_ID) Q03181-1 (M1-Y441) (Accession)

  • Smiles

    MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0027866
1 EachQM-0027866
£0.00/ea
£0.00
£0.00/ea £0.00

PPARD, Human (HEK293, His)

PPARD, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.