Skip to product information
1 of 1

PPIE, Human (His)

PPIE, Human (His)

Size

SKU:QM-0178216-01

£263.32 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The PPIE protein is a key spliceosome component that complexly regulates pre-mRNA splicing through RNA binding and PPIase activity. It prefers single-stranded RNA with polyA and polyU stretches, indicating an affinity for the poly (A) region of the 3'-UTR. PPIE Protein, Human (His) is the recombinant human-derived PPIE protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    10450 (Gene_ID) Q9UNP9 (M1-V301) (Accession)

  • Smiles

    MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV

  • Purity

    96.87

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0178216-01
10 µgQM-0178216-01
£263.32/ea
£0.00
£263.32/ea £0.00
50 µgQM-0178216-02
50 µgQM-0178216-02
£639.98/ea
£0.00
£639.98/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PPIE, Human (His)

PPIE, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.