Skip to product information
1 of 1

PPIH, Human (His)

PPIH, Human (His)

Size

SKU:QM-0172818-01

£241.46 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The PPIH protein is a peptidyl prolyl cis-trans isomerase (PPIase) that catalyzes the isomerization of prolyl imide peptide bonds and may contribute to protein folding. It plays a crucial role in pre-mRNA splicing and contributes to the formation of the U4/U5/U6 tri-snRNP complex in spliceosome assembly. PPIH Protein, Human (His) is the recombinant human-derived PPIH protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    10465 (Gene_ID) O43447-1 (M1-M177) (Accession)

  • Smiles

    MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

  • Purity

    95.66

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0172818-01
10 µgQM-0172818-01
£241.46/ea
£0.00
£241.46/ea £0.00
50 µgQM-0172818-02
50 µgQM-0172818-02
£573.15/ea
£0.00
£573.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PPIH, Human (His)

PPIH, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.