PPIL1, Human (His)

Name: PPIL1, Human (His)
Brand: QuantiMol
SKU: QM-0180189-01
Price: 230.52 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0180189-01

£230.52 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The PPIL1 protein is a spliceosome component that coordinates pre-mRNA splicing and controls RNA processing. As a peptidylprolyl cis-trans isomerase (PPIase), PPIL1 accelerates protein folding by catalyzing the cis-trans isomerization of proline imide peptide bonds. PPIL1 Protein, Human (His) is the recombinant human-derived PPIL1 protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
51645 (Gene_ID) Q9Y3C6 (M1-G166) (Accession)
Smiles
MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG
Purity
98
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0180189-01	10 µgQM-0180189-01 £230.52/ea	£0.00	Quantity	£230.52/ea	£0.00

50 µgQM-0180189-02	50 µgQM-0180189-02 £540.35/ea	£0.00	Quantity	£540.35/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PPIL1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.