PR-Set7, Human

Name: PR-Set7, Human
Brand: QuantiMol
SKU: QM-0202820-01
Price: 67.44 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202820-01

£67.44 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The PR-Set7 Protein methylates Lys-20 of histone H4, repressing gene transcription and aiding cell proliferation and chromatin condensation. It is expressed in multiple tissues, including the prostate (RPKM 17.6), esophagus (RPKM 16.8), and others. PR-Set7 Protein, Human is the recombinant human-derived PR-Set7 protein, expressed by E. coli , with tag free.
Molecular Formula
387893 (Gene_ID) Q9NQR1-2/NP_065115 (K195-H352) (Accession)
Smiles
KAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202820-01	5 µgQM-0202820-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0202820-02	10 µgQM-0202820-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0202820-03	50 µgQM-0202820-03 £249.26/ea	£0.00	Quantity	£249.26/ea	£0.00

100 µgQM-0202820-04	100 µgQM-0202820-04 £370.76/ea	£0.00	Quantity	£370.76/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PR-Set7, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.