Skip to product information
1 of 1

PRDX4, Human (His)

PRDX4, Human (His)

Size

SKU:QM-0192311-01

£263.32 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    PRDX4, a thiol-specific peroxidase, enzymatically reduces hydrogen peroxide and organic hydroperoxides, crucial for cellular protection. It detoxifies peroxides, acts as a sensor for hydrogen peroxide-mediated signaling, and contributes to NF-kappa-B activation regulation. PRDX4's multifaceted activity underscores its significance in cellular redox homeostasis and potential impact on intracellular signaling. PRDX4 Protein, Human (His) is the recombinant human-derived PRDX4 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    10549 (Gene_ID) Q13162 (W38-N271) (Accession)

  • Smiles

    WETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

  • Purity

    97

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0192311-01
10 µgQM-0192311-01
£263.32/ea
£0.00
£263.32/ea £0.00
50 µgQM-0192311-02
50 µgQM-0192311-02
£639.98/ea
£0.00
£639.98/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PRDX4, Human (His)

PRDX4, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.