Skip to product information
1 of 1

PRDX5/Peroxiredoxin-5, Human (HEK293, His)

PRDX5/Peroxiredoxin-5, Human (HEK293, His)

Size

SKU:QM-0175910-01

£137.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The PRDX5 protein (or Peroxiredoxin-5) plays a critical role as a thiol-specific peroxidase that reduces hydrogen peroxide and organic hydroperoxides. This enzyme activity is essential for cells to defend against oxidative stress and detoxify peroxides. PRDX5/Peroxiredoxin-5 Protein, Human (HEK293, His) is the recombinant human-derived PRDX5/Peroxiredoxin-5 protein, expressed by HEK293 , with N-6*His labeled tag.

  • Molecular Formula

    25824 (Gene_ID) P30044-1 (M53-L214) (Accession)

  • Smiles

    MAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0175910-01
10 µgQM-0175910-01
£137.50/ea
£0.00
£137.50/ea £0.00
50 µgQM-0175910-02
50 µgQM-0175910-02
£415.71/ea
£0.00
£415.71/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PRDX5/Peroxiredoxin-5, Human (HEK293, His)

PRDX5/Peroxiredoxin-5, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.