1 1

PRKCE, Human (His)

PRKCE, Human (His)

Size

QM-0076404

Price on request

Request quote or documents

View full details

Product Details

  • Description

    PKCE proteins are calcium-independent, phospholipid- and diacylglycerol (DAG) -dependent serine/threonine protein kinases. PRKCE Protein, Human (His) is the recombinant human-derived PKCE protein, expressed by E. coli , with C-6*His labeled tag.

  • Molecular Formula

    5581 (Gene_ID) Q02156 (Q580-P737) (Accession)

  • Smiles

    QELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP

  • Shipping Conditions

    Dry ice.
Learn more
Variant Variant total Quantity Price Variant total
1 EachQM-0076404
1 EachQM-0076404
£0.00/ea		 £0.00
£0.00/ea £0.00

Related Products

Other industry favorites

PRKCE, Human (His)

PRKCE, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.