PRNP/CD230, Human (HEK293, hFc)

Name: PRNP/CD230, Human (HEK293, hFc)
Brand: QuantiMol
SKU: QM-0203650-01
Price: 67.44 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203650-01

£67.44 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Although its primary function is unknown, the PRNP/CD230 protein has been implicated in multiple neuronal processes, including neuronal development, synaptic plasticity, and myelin homeostasis. PRNP acts as an agonist of the ADGRG6 receptor and promotes the maintenance of myelin. PRNP/CD230 Protein, Human (HEK293, Fc) is the recombinant human-derived PRNP/CD230 protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
5621 (Gene_ID) P04156 (K23-G229) (Accession)
Smiles
KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRG
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203650-01	5 µgQM-0203650-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0203650-02	10 µgQM-0203650-02 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

50 µgQM-0203650-03	50 µgQM-0203650-03 £288.14/ea	£0.00	Quantity	£288.14/ea	£0.00

100 µgQM-0203650-04	100 µgQM-0203650-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PRNP/CD230, Human (HEK293, hFc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.