Skip to product information
1 of 1

Proinsulin, Human (His)

Proinsulin, Human (His)

Size

SKU:QM-0205636-01

£73.65 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Proinsulin is the precursor of insulin, a key hormone that regulates carbohydrate and lipid metabolism. Post-translational cleavage produces insulin, which consists of B and A chain peptides and a C peptide linked by disulfide bonds. Proinsulin Protein, Human (His) is the recombinant human-derived Proinsulin protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    3630 (Gene_ID) NP_000198.1 (F25-N110) (Accession)

  • Smiles

    FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205636-01
2 µgQM-0205636-01
£73.65/ea
£0.00
£73.65/ea £0.00
10 µgQM-0205636-02
10 µgQM-0205636-02
£199.44/ea
£0.00
£199.44/ea £0.00
50 µgQM-0205636-03
50 µgQM-0205636-03
£437.58/ea
£0.00
£437.58/ea £0.00
100 µgQM-0205636-04
100 µgQM-0205636-04
£669.65/ea
£0.00
£669.65/ea £0.00
250 µgQM-0205636-05
250 µgQM-0205636-05
£1,212.76/ea
£0.00
£1,212.76/ea £0.00
500 µgQM-0205636-06
500 µgQM-0205636-06
£1,821.47/ea
£0.00
£1,821.47/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Proinsulin, Human (His)

Proinsulin, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.