Prokineticin-1/EG-VEGF, Human

Name: Prokineticin-1/EG-VEGF, Human
Brand: QuantiMol
SKU: QM-0027560-01
Price: 67.44 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0027560-01

£67.44 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Prokineticin-1/EG-VEGF protein is a potent regulator of gastrointestinal smooth muscle contraction and affects intestinal motility. Its multifaceted effects extend to capillary endothelial cells, inducing proliferation, migration, and fenestration and are specific to certain cell types. Prokineticin-1/EG-VEGF Protein, Human is the recombinant human-derived Prokineticin-1/EG-VEGF protein, expressed by E. coli , with tag free.
Molecular Formula
84432 (Gene_ID) P58294 (A20-F105) (Accession)
Smiles
AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0027560-01	5 µgQM-0027560-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0027560-02	10 µgQM-0027560-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0027560-03	50 µgQM-0027560-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

100 µgQM-0027560-04	100 µgQM-0027560-04 £404.78/ea	£0.00	Quantity	£404.78/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Prokineticin-1/EG-VEGF, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.