Prolactin, Sheep (HEK293, His)

Name: Prolactin, Sheep (HEK293, His)
Brand: QuantiMol
SKU: QM-0202598-01
Price: 107.13 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0202598-01

£107.13 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Prolactin Protein, Sheep, (HEK293, His) is a recombinant protein produced by HEK293 cells. Prolactin (PRL) is a 199-amino acid polypeptide hormone mainly synthesized by lactotrope cells in the anterior pituitary. In rodents, PRL has been detected in the preoptic area, hypothalamus, amygdala, and brainstem[1].
Molecular Formula
443317 (Gene_ID) P01240 (T31-C229) (Accession)
Smiles
TPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202598-01	5 µgQM-0202598-01 £107.13/ea	£0.00	Quantity	£107.13/ea	£0.00

10 µgQM-0202598-02	10 µgQM-0202598-02 £199.44/ea	£0.00	Quantity	£199.44/ea	£0.00

50 µgQM-0202598-03	50 µgQM-0202598-03 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

100 µgQM-0202598-04	100 µgQM-0202598-04 £669.65/ea	£0.00	Quantity	£669.65/ea	£0.00

500 µgQM-0202598-05	500 µgQM-0202598-05 £1,710.90/ea	£0.00	Quantity	£1,710.90/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Prolactin, Sheep (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.