Skip to product information
1 of 1

Protein E6, HPV16 (His)

Protein E6, HPV16 (His)

Size

SKU:QM-0205053-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    HPV16 E6 is a viral phosphoprotein with oncogenic activity, belonging to the human papillomavirus early protein family. HPV16 E6 activates the cell cycle by releasing E2F through proteasome degradation of pRB. HPV16 E6 can cooperate with E6 to immortalize cells and neutralize the toxicity of E5, while activating the AP-1/NF-κB pathway and downregulating E-cadherin to enhance migration and invasion, making it a core target for cervical cancer. Protein E6, HPV16 (His) is a recombinant HPV E6 protein expressed from E. coli with an N-6*His tag.

  • Molecular Formula

    1489078 (Gene_ID) P03126 (M1-L158) (Accession)

  • Smiles

    MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205053-01
2 µgQM-0205053-01
£52.94/ea
£0.00
£52.94/ea £0.00
5 µgQM-0205053-02
5 µgQM-0205053-02
£76.75/ea
£0.00
£76.75/ea £0.00
10 µgQM-0205053-03
10 µgQM-0205053-03
£107.13/ea
£0.00
£107.13/ea £0.00
50 µgQM-0205053-04
50 µgQM-0205053-04
£288.14/ea
£0.00
£288.14/ea £0.00
100 µgQM-0205053-05
100 µgQM-0205053-05
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Protein E6, HPV16 (His)

Protein E6, HPV16 (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.