Skip to product information
1 of 1

PRTFDC1, Human (His)

PRTFDC1, Human (His)

Size

SKU:QM-0194605-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    PRTFDC1 protein, with minimal phosphoribosyltransferase activity, shows low in vitro detection levels. It binds GMP, IMP, and PRPP, yet its involvement in purine metabolism or salvage is not expected. Functioning as a homodimer, its structural configuration highlights its role in cellular processes. PRTFDC1 Protein, Human (His) is the recombinant human-derived PRTFDC1 protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    56952 (Gene_ID) Q9NRG1-1 (M1-V225) (Accession)

  • Smiles

    MAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIMVLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV

  • Purity

    95.6

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0194605-01
5 µgQM-0194605-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0194605-02
10 µgQM-0194605-02
£81.92/ea
£0.00
£81.92/ea £0.00
50 µgQM-0194605-03
50 µgQM-0194605-03
£238.32/ea
£0.00
£238.32/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PRTFDC1, Human (His)

PRTFDC1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.