Skip to product information
1 of 1

PSAT1, Human (His)

PSAT1, Human (His)

Size

SKU:QM-0203781-01

£132.13 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The PSAT1 protein plays a central role in cellular metabolism by catalyzing the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and 3-hydroxy-2-oxo-4-phosphonooxybutyrate to phosphohydroxythreonine. These enzyme activities are key steps in the biosynthetic pathway of the essential amino acids serine and threonine. PSAT1 Protein, Human (His) is the recombinant human-derived PSAT1 protein, expressed by E. coli , with C-6*His labeled tag.

  • Molecular Formula

    29968 (Gene_ID) Q9Y617-1 (M1-L370) (Accession)

  • Smiles

    MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL

  • Purity

    96

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203781-01
5 µgQM-0203781-01
£132.13/ea
£0.00
£132.13/ea £0.00
10 µgQM-0203781-02
10 µgQM-0203781-02
£230.52/ea
£0.00
£230.52/ea £0.00
50 µgQM-0203781-03
50 µgQM-0203781-03
£517.26/ea
£0.00
£517.26/ea £0.00
100 µgQM-0203781-04
100 µgQM-0203781-04
£827.09/ea
£0.00
£827.09/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PSAT1, Human (His)

PSAT1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.