1 1

PSMD14, Mouse (His)

PSMD14, Mouse (His)

Size

QM-0099713

£990.41 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    PSMD14 Protein, Mouse (His) is the recombinant mouse-derived PSMD14, expressed by E. coli , with C-6*His labeled tag.

  • Molecular Formula

    59029 (Gene_ID) O35593 (M1-N166) (Accession)

  • Smiles

    MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINAN

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
50 µgQM-0099713
50 µgQM-0099713
£990.41/ea		 £0.00
£990.41/ea £0.00

Related Products

Other industry favorites

PSMD14, Mouse (His)

PSMD14, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.