Skip to product information
1 of 1

PSME1, Human (His)

PSME1, Human (His)

Size

SKU:QM-0205803-01

£67.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The PSME1 protein is critical for immunoproteasome assembly and is essential for efficient antigen processing. As part of the PA28 activator complex, PSME1, together with PSME2, actively enhances the production of class I binding peptides by altering the cleavage pattern of the proteasome. PSME1 Protein, Human (His) is the recombinant human-derived PSME1 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    5720 (Gene_ID) Q06323 (A2-Y249) (Accession)

  • Smiles

    AMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0205803-01
5 µgQM-0205803-01
£67.44/ea
£0.00
£67.44/ea £0.00
10 µgQM-0205803-02
10 µgQM-0205803-02
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0205803-03
50 µgQM-0205803-03
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0205803-04
100 µgQM-0205803-04
£426.65/ea
£0.00
£426.65/ea £0.00
500 µgQM-0205803-05
500 µgQM-0205803-05
£1,100.97/ea
£0.00
£1,100.97/ea £0.00
1 mgQM-0205803-06
1 mgQM-0205803-06
£1,710.90/ea
£0.00
£1,710.90/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PSME1, Human (His)

PSME1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.